Tesamorelin and Ipamorelin (Blend) (8mg)
Tesamorelin and Ipamorelin (Blend) (8mg) view 1
Tesamorelin and Ipamorelin (Blend) (8mg) view 2
Peptide Capsules
Verified Quality

Tesamorelin and Ipamorelin (Blend) (8mg)

4.88 (34 Reviews)
Ships worldwide
$115.00

Sales Tax included at checkout

Laboratory Research Chemical • Scroll down for full specifications

1

Priority Shipping

Fast & Discreet

99% Purity

HPLC Verified

Full Refund

60-Day Promise

Lab Synthesis

GMP Certified

Product Information

Detailed laboratory specifications, compound structure, and research applications.

Research Grade

HPLC 99%+ Purity

Verified Origin

GMP Manufactured

Tesamorelin and Ipamorelin Blend Product Description

The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin and Ipamorelin Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

  • Tesamorelin acetate
  • 901758-09-6
  • TH9507
  • UNII-LGW5H38VE3
  • Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C38H49N9O5

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

  • 170851-70-4
  • Ipamorelin [INN]
  • NNC-26-0161
  • UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Research Chemical Disclaimer

This product is intended for laboratory research use only. It is not for human consumption, diagnostic, or therapeutic purposes. Handling should only be performed by qualified professionals.

Complete Your Research

Synergistic compounds from the Peptide Capsules lineup

View Full Collection
MicroFLGR (2MG)

MicroFLGR (2MG)

Product Description

Follistatin (FLGR242), is a novel fragmented, modified version of Follistatin-344 (FST-344) that does not bind to the protein activin. Activin is responsible for the negative effects of myostatin inhibition such as unwanted cellular growth in laboratory models. It also contains a patented albumin binder.

Follistatin protein (FST) fused with an albumin-binding construct that uses a hydrophilic glycine-serine linker to achieve high-affinity binding to serum albumin (<20 nM Kd). This recombinant technology allows researchers to study follistatin-albumin interactions and protein trafficking in experimental systems.

Research applications include muscle mass development studies, activin neutralization assays, and TGF-β superfamily pathway modulation with albumin binding dynamics. The construct maintains biological activity while enabling investigation of albumin as a carrier protein.

US GMP-manufactured with third-party verification and comprehensive COAs for reproducible research outcomes.

Peptide Information

Property Value
Peptide Type Follistatin-Albumin Binding Construct
Technology Albumin-binding peptide fusion (GGSGGSGGSGGRLIEDICLPRWGCLWEDD linker)
Molecular Weight ~40 kDa
Binding Affinity <20 nM
Synonyms FST-Albumin Construct, Extended Half-Life Follistatin

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.  This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

$15000.00

Follistatin (FLGR242) (10mg)
Options

Follistatin (FLGR242) (10mg)

Product Description

Follistatin (FLGR242), is a novel fragmented, modified version of Follistatin-344 (FST-344) that does not bind to the protein activin. Activin is responsible for the negative effects of myostatin inhibition such as unwanted cellular growth in laboratory models. It also contains a patented albumin binder.

Follistatin protein (FST) fused with an albumin-binding construct that uses a hydrophilic glycine-serine linker to achieve high-affinity binding to serum albumin (<20 nM Kd). This recombinant technology allows researchers to study follistatin-albumin interactions and protein trafficking in experimental systems.

Research applications include muscle mass development studies, activin neutralization assays, and TGF-β superfamily pathway modulation with albumin binding dynamics. The construct maintains biological activity while enabling investigation of albumin as a carrier protein.

US GMP-manufactured with third-party verification and comprehensive COAs for reproducible research outcomes.

Peptide Information

Property Value
Peptide Type Follistatin-Albumin Binding Construct
Technology Albumin-binding peptide fusion (GGSGGSGGSGGRLIEDICLPRWGCLWEDD linker)
Molecular Weight ~40 kDa
Binding Affinity <20 nM
Synonyms FST-Albumin Construct, Extended Half-Life Follistatin

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.  This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

$2397 – $28764

Klotho (alphaKlothoLR) (20mcg)
Options

Klotho (alphaKlothoLR) (20mcg)

Product Description

alphaKlothoLR is a patented, long-release version of the recombinant Klotho protein, which contains specific amino acid sequences, linkers, and an albumin binding group that allows for a sustained delivery of Klotho with cellular activity up to 19 days.

This research-grade construct combines α-Klotho protein with a proprietary 29-amino acid albumin binding peptide (GGSGGSGGSGGRLIEDICLPRWGCLWEDD). The modification enables strong albumin binding affinity (<20 nM) while maintaining native FGF23 binding activity (15-30 nM).

Produced through recombinant expression with rigorous third-party testing. Each batch includes HPLC and LC-MS verification to confirm molecular identity and purity standards. Complete analytical documentation supports laboratory applications investigating protein-albumin interactions, FGF23 signaling pathways, and albumin binding mechanisms.

For in vitro research use only.

Klotho Protein Information

Property Value
Peptide Sequence α-Klotho protein (1012 amino acids) + albumin binding construct: GGSGGSGGSGGRLIEDICLPRWGCLWEDD
Molecular Weight ~133-135 kDa (full construct with albumin binder)
Albumin Binding Affinity (Kd) <20 nM
FGF23 Binding Affinity (Kd) 15-30 nM (optimized: 16.2 nM)
Synonyms α-Klotho-albumin binding construct, Modified Klotho with glycine-serine linker

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.  This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

$2397 – $15341

Research Specification

Comprehensive documentation for laboratory application and compound verification.

HPLC Verification

Purity levels exceeding 99.2% guaranteed via third-party high-performance liquid chromatography testing.

Storage Compliance

Stored at -20°C in oxygen-free environment. Shipped with cold-chain monitoring protocols.

CAS Registry

Uniquely identified compound with full structural validation and mass spectrometry reports.

Usage Policy

Strictly for lab research. Not for human or therapeutic use. Waiver required for bulk orders.